Lineage for d3mm5d3 (3mm5 D:239-304)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906288Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 1906422Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 1906459Protein DsrA insert domain [160280] (2 species)
  7. 1906460Species Archaeoglobus fulgidus [TaxId:2234] [160282] (8 PDB entries)
    Uniprot Q59109 240-305
  8. 1906462Domain d3mm5d3: 3mm5 D:239-304 [213374]
    Other proteins in same PDB: d3mm5a1, d3mm5a2, d3mm5b1, d3mm5b2, d3mm5b3, d3mm5d1, d3mm5d2, d3mm5e1, d3mm5e2, d3mm5e3
    automated match to d3mmca1
    complexed with sf4, so3, srm

Details for d3mm5d3

PDB Entry: 3mm5 (more details), 1.8 Å

PDB Description: dissimilatory sulfite reductase in complex with the substrate sulfite
PDB Compounds: (D:) sulfite reductase, dissimilatory-type subunit alpha

SCOPe Domain Sequences for d3mm5d3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mm5d3 d.58.1.5 (D:239-304) DsrA insert domain {Archaeoglobus fulgidus [TaxId: 2234]}
kddikvdqeavkeyaswmdienevvklcptgaikwdgkeltidnrecvrcmhcinkmpka
lkpgde

SCOPe Domain Coordinates for d3mm5d3:

Click to download the PDB-style file with coordinates for d3mm5d3.
(The format of our PDB-style files is described here.)

Timeline for d3mm5d3: