Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (3 families) forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.1.0: automated matches [191544] (1 protein) not a true family |
Protein automated matches [190935] (11 species) not a true protein |
Species Entamoeba histolytica [TaxId:294381] [225859] (2 PDB entries) |
Domain d3m4sc_: 3m4s C: [213128] automated match to d3v4dc_ complexed with cl |
PDB Entry: 3m4s (more details), 2.3 Å
SCOPe Domain Sequences for d3m4sc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m4sc_ d.79.1.0 (C:) automated matches {Entamoeba histolytica [TaxId: 294381]} kltvvasplapeavgaysqaiicngmvycsgqigldrktgdfagktieeqskqvmtnlky vleeagssmdkvvkttclladikdfgvfngiyaeafgnhkparacfaaaalpkgalveve ciatl
Timeline for d3m4sc_: