Lineage for d3m4sc_ (3m4s C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2958619Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2958881Family d.79.1.0: automated matches [191544] (1 protein)
    not a true family
  6. 2958882Protein automated matches [190935] (24 species)
    not a true protein
  7. 2958941Species Entamoeba histolytica [TaxId:294381] [225859] (2 PDB entries)
  8. 2958945Domain d3m4sc_: 3m4s C: [213128]
    automated match to d3v4dc_
    complexed with cl

Details for d3m4sc_

PDB Entry: 3m4s (more details), 2.3 Å

PDB Description: Crystal structure of a putative endoribonuclease L-PSP from Entamoeba histolytica, orthorhombic form
PDB Compounds: (C:) putative Endoribonuclease L-PSP

SCOPe Domain Sequences for d3m4sc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m4sc_ d.79.1.0 (C:) automated matches {Entamoeba histolytica [TaxId: 294381]}
kltvvasplapeavgaysqaiicngmvycsgqigldrktgdfagktieeqskqvmtnlky
vleeagssmdkvvkttclladikdfgvfngiyaeafgnhkparacfaaaalpkgalveve
ciatl

SCOPe Domain Coordinates for d3m4sc_:

Click to download the PDB-style file with coordinates for d3m4sc_.
(The format of our PDB-style files is described here.)

Timeline for d3m4sc_: