Lineage for d3lwba1 (3lwb A:7-150)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2862338Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2862339Protein automated matches [226903] (40 species)
    not a true protein
  7. 2862447Species Mycobacterium tuberculosis [TaxId:1773] [225851] (1 PDB entry)
  8. 2862448Domain d3lwba1: 3lwb A:7-150 [213077]
    Other proteins in same PDB: d3lwba2, d3lwbb2
    automated match to d1ehib1
    complexed with no3

Details for d3lwba1

PDB Entry: 3lwb (more details), 2.1 Å

PDB Description: crystal structure of apo d-alanine:d-alanine ligase (ddl) from mycobacterium tuberculosis
PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d3lwba1:

Sequence, based on SEQRES records: (download)

>d3lwba1 c.30.1.0 (A:7-150) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
rdrrvrvavvfggrsnehaiscvsagsilrnldsrrfdviavgitpagswvltdanpdal
titnrelpqvksgsgtelalpadprrggqlvslppgagevlesvdvvfpvlhgpygedgt
iqgllelagvpyvgagvlasavgm

Sequence, based on observed residues (ATOM records): (download)

>d3lwba1 c.30.1.0 (A:7-150) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
rdrrvrvavvfggaiscvsagsilrnldsrrfdviavgitpagswvltdanvslppgage
vlesvdvvfpvlhgpygedgtiqgllelagvpyvgagvlasavgm

SCOPe Domain Coordinates for d3lwba1:

Click to download the PDB-style file with coordinates for d3lwba1.
(The format of our PDB-style files is described here.)

Timeline for d3lwba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lwba2