Class b: All beta proteins [48724] (177 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.5: Actin-crosslinking proteins [50405] (3 families) |
Family b.42.5.1: Fascin [50406] (1 protein) automatically mapped to Pfam PF06268 |
Protein Fascin [50407] (1 species) duplication: tandem repeat of four domains |
Species Human (Homo sapiens) [TaxId:9606] [50408] (8 PDB entries) |
Domain d3llpb4: 3llp B:383-493 [212933] automated match to d1dfca4 complexed with br, epe, gol, k, so4 |
PDB Entry: 3llp (more details), 1.8 Å
SCOPe Domain Sequences for d3llpb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3llpb4 b.42.5.1 (B:383-493) Fascin {Human (Homo sapiens) [TaxId: 9606]} rpiivfrgehgfigcrkvtgtldanrssydvfqlefndgaynikdstgkywtvgsdsavt ssgdtpvdfffefcdynkvaikvggrylkgdhagvlkasaetvdpaslwey
Timeline for d3llpb4:
View in 3D Domains from other chains: (mouse over for more information) d3llpa1, d3llpa2, d3llpa3, d3llpa4 |