![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.5: Actin-crosslinking proteins [50405] (3 families) ![]() |
![]() | Family b.42.5.1: Fascin [50406] (1 protein) automatically mapped to Pfam PF06268 |
![]() | Protein Fascin [50407] (1 species) duplication: tandem repeat of four domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50408] (6 PDB entries) |
![]() | Domain d3llpa2: 3llp A:141-259 [212927] automated match to d1dfca2 complexed with br, epe, gol, k, so4 |
PDB Entry: 3llp (more details), 1.8 Å
SCOPe Domain Sequences for d3llpa2:
Sequence, based on SEQRES records: (download)
>d3llpa2 b.42.5.1 (A:141-259) Fascin {Human (Homo sapiens) [TaxId: 9606]} qvniysvtrkryahlsarpadeiavdrdvpwgvdslitlafqdqrysvqtadhrflrhdg rlvarpepatgytlefrsgkvafrdcegrylapsgpsgtlkagkatkvgkdelfaleqs
>d3llpa2 b.42.5.1 (A:141-259) Fascin {Human (Homo sapiens) [TaxId: 9606]} qvniysvtrkryahlsaadeiavdrdvpwgvdslitlafqdqrysvqtadhrflrhdgrl varpepatgytlefrkvafrdcegrylapsgpsgtlkagkvgkdelfaleqs
Timeline for d3llpa2:
![]() Domains from other chains: (mouse over for more information) d3llpb1, d3llpb2, d3llpb3, d3llpb4 |