SCOP 1.65: Domain d25c8l2: 25c8 L:108-211

Lineage for d25c8l2 (25c8 L:108-211)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries)

8. Domain d25c8l2: 25c8 L:108-211 [21290]
   Other proteins in same PDB: d25c8h1, d25c8h2, d25c8l1
   part of catalytic Fab 5C8
   complexed with gep

Details for d25c8l2

PDB Entry: 25c8, 2 Å

PDB Description: catalytic antibody 5c8, fab-hapten complex

SCOP Domain Sequences for d25c8l2:

Sequence; same for both SEQRES and ATOM records:

>d25c8l2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d25c8l2:

• d25c8l2 first appeared (with stable ids) in SCOP 1.55
  
• d25c8l2 appears in SCOP 1.63
  
• d25c8l2 appears in SCOP 1.67
  
• d25c8l2 appears in the current release, SCOPe 2.08