Lineage for d3lcid_ (3lci D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834988Protein automated matches [190095] (28 species)
    not a true protein
  7. 2835019Species Escherichia coli K-12 [TaxId:83333] [225841] (10 PDB entries)
  8. 2835053Domain d3lcid_: 3lci D: [212809]
    automated match to d2wnqa_
    complexed with so4; mutant

Details for d3lcid_

PDB Entry: 3lci (more details), 2.12 Å

PDB Description: the d-sialic acid aldolase mutant v251w
PDB Compounds: (D:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d3lcid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lcid_ c.1.10.1 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
matnlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslsere
qvleivaeeakgkikliahvgcvstaesqqlaasakrygfdavsavtpfyypfsfeehcd
hyraiidsadglpmvvynipalsgvkltldqintlvtlpgvgalkqtsgdlyqmeqirre
hpdlvlyngydeifasgllagadggigstynimgwryqgivkalkegdiqtaqklqtecn
kvidlliktgwfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmqer

SCOPe Domain Coordinates for d3lcid_:

Click to download the PDB-style file with coordinates for d3lcid_.
(The format of our PDB-style files is described here.)

Timeline for d3lcid_: