SCOP 1.73: Domain d1a3ll2: 1a3l L:108-212

Lineage for d1a3ll2 (1a3l L:108-212)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)

8. Domain d1a3ll2: 1a3l L:108-212 [21252]
   Other proteins in same PDB: d1a3lh1, d1a3lh2, d1a3ll1
   part of Diels-Alder catalytic Fab 13G5
   complexed with cfc

Details for d1a3ll2

PDB Entry: 1a3l, 1.95 Å

PDB Description: catalysis of a disfavored reaction: an antibody exo diels-alderase-tsa-inhibitor complex at 1.95 a resolution

PDB Compounds: (L:) immunoglobulin fab 13g5 (light chain)

SCOP Domain Sequences for d1a3ll2:

Sequence; same for both SEQRES and ATOM records:

>d1a3ll2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
tkdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d1a3ll2:

• d1a3ll2 first appeared (with stable ids) in SCOP 1.55
  
• d1a3ll2 appears in SCOP 1.71
  
• d1a3ll2 appears in SCOP 1.75
  
• d1a3ll2 appears in the current release, SCOPe 2.08