Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.14: RNA helicase [52724] (4 proteins) duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension |
Protein HCV helicase domain [52725] (1 species) |
Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (17 PDB entries) |
Domain d3kqna1: 3kqn A:189-325 [212501] automated match to d1heia1 protein/DNA complex; complexed with adp, bef, mn |
PDB Entry: 3kqn (more details), 2.05 Å
SCOPe Domain Sequences for d3kqna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kqna1 c.37.1.14 (A:189-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} sppavpqtfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskahgi dpnirtgvrtittgapitystygkfladggcsggaydiiicdechstdsttilgigtvld qaetagarlvvlatatp
Timeline for d3kqna1: