SCOPe 2.06: Domain d3kmnb1: 3kmn B:1-78

Lineage for d3kmnb1 (3kmn B:1-78)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (106 PDB entries)

8. Domain d3kmnb1: 3kmn B:1-78 [212425]
   Other proteins in same PDB: d3kmna2, d3kmnb2
   automated match to d1gssa2
   complexed with ca, co3, po4; mutant

Details for d3kmnb1

PDB Entry: 3kmn, 1.8 Å

PDB Description: crystal structure of the human apo gst pi c47s/y108v double mutant

PDB Compounds: (B:) Glutathione S-transferase P

SCOPe Domain Sequences for d3kmnb1:

Sequence; same for both SEQRES and ATOM records:

>d3kmnb1 c.47.1.0 (B:1-78) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasslygqlpkfqdgdl
tlyqsntilrhlgrtlgl

Timeline for d3kmnb1:

• d3kmnb1 first appeared in SCOPe 2.03
  
• d3kmnb1 appears in SCOPe 2.05
  
• d3kmnb1 appears in SCOPe 2.07
  
• d3kmnb1 appears in the current release, SCOPe 2.08