Lineage for d3km6a1 (3km6 A:2-78)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2134369Species Human (Homo sapiens) [TaxId:9606] [188013] (106 PDB entries)
  8. 2134468Domain d3km6a1: 3km6 A:2-78 [212419]
    Other proteins in same PDB: d3km6a2, d3km6b2
    automated match to d1gssa2
    complexed with ca, eaa, gsh; mutant

Details for d3km6a1

PDB Entry: 3km6 (more details), 2.1 Å

PDB Description: crystal structure of the human gst pi c47s/y108v double mutant in complex with the ethacrynic acid-glutathione conjugate
PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d3km6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3km6a1 c.47.1.0 (A:2-78) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasslygqlpkfqdgdlt
lyqsntilrhlgrtlgl

SCOPe Domain Coordinates for d3km6a1:

Click to download the PDB-style file with coordinates for d3km6a1.
(The format of our PDB-style files is described here.)

Timeline for d3km6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3km6a2