SCOPe 2.04: Domain d3kksb_: 3kks B:

Lineage for d3kksb_ (3kks B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (26 species)
   not a true protein

7. Species Bovine immunodeficiency virus [TaxId:417296] [225970] (2 PDB entries)

8. Domain d3kksb_: 3kks B: [212403]
   automated match to d4jlha_
   complexed with act, gol

Details for d3kksb_

PDB Entry: 3kks, 2.2 Å

PDB Description: Crystal structure of catalytic core domain of BIV integrase in crystal form II

PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d3kksb_:

Sequence; same for both SEQRES and ATOM records:

>d3kksb_ c.55.3.0 (B:) automated matches {Bovine immunodeficiency virus [TaxId: 417296]}
gshlwqmdnthwnktiiwvavetnsglveaqvipeetalqvalcilqliqrytvlhlhsd
ngpcftahrienlckylgitkttgipynpqsqgvverahrdlkdrlaayqgdcetveaal
slalvslnkkrggigghtpyeiylesehtkyq

Timeline for d3kksb_:

• d3kksb_ first appeared in SCOPe 2.03
  
• d3kksb_ appears in SCOPe 2.05
  
• d3kksb_ appears in the current release, SCOPe 2.08, called d3kksb1