Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (26 species) not a true protein |
Species Bovine immunodeficiency virus [TaxId:417296] [225970] (2 PDB entries) |
Domain d3kksb_: 3kks B: [212403] automated match to d4jlha_ complexed with act, gol |
PDB Entry: 3kks (more details), 2.2 Å
SCOPe Domain Sequences for d3kksb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kksb_ c.55.3.0 (B:) automated matches {Bovine immunodeficiency virus [TaxId: 417296]} gshlwqmdnthwnktiiwvavetnsglveaqvipeetalqvalcilqliqrytvlhlhsd ngpcftahrienlckylgitkttgipynpqsqgvverahrdlkdrlaayqgdcetveaal slalvslnkkrggigghtpyeiylesehtkyq
Timeline for d3kksb_: