Class a: All alpha proteins [46456] (285 folds) |
Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily) core: 4 helices: bundle; unusual topology |
Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) duplication: consists of 2 helix-loop-helix structural repeats automatically mapped to Pfam PF02877 |
Family a.41.1.0: automated matches [227223] (1 protein) not a true family |
Protein automated matches [226964] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225405] (24 PDB entries) |
Domain d3kjda1: 3kjd A:226-364 [212388] Other proteins in same PDB: d3kjda2, d3kjdb2 automated match to d1gs0a1 protein/DNA complex; complexed with 78p, gol |
PDB Entry: 3kjd (more details), 1.95 Å
SCOPe Domain Sequences for d3kjda1:
Sequence, based on SEQRES records: (download)
>d3kjda1 a.41.1.0 (A:226-364) automated matches {Human (Homo sapiens) [TaxId: 9606]} tenlyfqsmdlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslkki edciragqhgralmeacnefytriphdfglrtpplirtqkelsekiqllealgdieiaik lvktelqspehpldqhyrn
>d3kjda1 a.41.1.0 (A:226-364) automated matches {Human (Homo sapiens) [TaxId: 9606]} tenlyfqsmdlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslkki edciragqhgralmeacnefytriphdfglrtpplirtqkelsekiqllealgdieiaik lvkspehpldqhyrn
Timeline for d3kjda1: