Lineage for d3kipr_ (3kip R:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1839588Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 1839934Family c.23.13.0: automated matches [191662] (1 protein)
    not a true family
  6. 1839935Protein automated matches [191250] (3 species)
    not a true protein
  7. 1839975Species Yeast (Candida albicans) [TaxId:5476] [225888] (1 PDB entry)
  8. 1839993Domain d3kipr_: 3kip R: [212380]
    automated match to d1uqra_
    complexed with so4, trs

Details for d3kipr_

PDB Entry: 3kip (more details), 2.95 Å

PDB Description: Crystal structure of type-II 3-dehydroquinase from C. albicans
PDB Compounds: (R:) 3-dehydroquinase, type II

SCOPe Domain Sequences for d3kipr_:

Sequence, based on SEQRES records: (download)

>d3kipr_ c.23.13.0 (R:) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
lvkkvllingpnlnllgtrepekygttslsdieqaaieqaklknndsevlvfqsntegfi
idriheakrqgvgfvvinagaythtsvgirdallgtaipfievhitnvhqrepfrhqsyl
sdkavavicglgvygytaaieyalnyql

Sequence, based on observed residues (ATOM records): (download)

>d3kipr_ c.23.13.0 (R:) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
lvkkvllingpnlnllgtrygttslsdieqaaieqaklknndsevlvfqsntegfiidri
heakrqgvgfvvinagaythtsvgirdallgtaipfievhitnvhqrepfrhqsylsdka
vavicglgvygytaaieyalnyql

SCOPe Domain Coordinates for d3kipr_:

Click to download the PDB-style file with coordinates for d3kipr_.
(The format of our PDB-style files is described here.)

Timeline for d3kipr_: