Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
Protein automated matches [226983] (18 species) not a true protein |
Species Thermococcus kodakaraensis [TaxId:69014] [225982] (2 PDB entries) |
Domain d3kdoj1: 3kdo J:7-135 [212341] Other proteins in same PDB: d3kdoa2, d3kdob2, d3kdoc2, d3kdod2, d3kdoe2, d3kdof2, d3kdog2, d3kdoh2, d3kdoi2, d3kdoj2 automated match to d1bxna2 complexed with cap, mg; mutant |
PDB Entry: 3kdo (more details), 2.36 Å
SCOPe Domain Sequences for d3kdoj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kdoj1 d.58.9.0 (J:7-135) automated matches {Thermococcus kodakaraensis [TaxId: 69014]} tiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqer wadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledl yfpeklire
Timeline for d3kdoj1: