SCOPe 2.05: Domain d3k9ua_: 3k9u A:

Lineage for d3k9ua_ (3k9u A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (32 species)
   not a true protein

7. Species Thermoplasma acidophilum [TaxId:2303] [225555] (4 PDB entries)

8. Domain d3k9ua_: 3k9u A: [212252]
   automated match to d1tiqa_
   complexed with aco, br, cl, ni

Details for d3k9ua_

PDB Entry: 3k9u, 2.3 Å

PDB Description: crystal structure of paia acetyltransferase (ta0374) from thermoplasma acidophilum

PDB Compounds: (A:) PaiA Acetyltransferase

SCOPe Domain Sequences for d3k9ua_:

Sequence; same for both SEQRES and ATOM records:

>d3k9ua_ d.108.1.0 (A:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
msieirklsiedletlievareswkwtyagiyseeyieswirekyskekllneivrsqsn
ldilflgafadstligfielkiiankaellrlylkpeythkkigktllleaekimkkkgi
lecrlyvhrqnsvgfsfyykngfkvedtdgsdfimekky

Timeline for d3k9ua_:

• d3k9ua_ first appeared in SCOPe 2.03
  
• d3k9ua_ appears in SCOPe 2.04
  
• d3k9ua_ appears in SCOPe 2.06
  
• d3k9ua_ appears in the current release, SCOPe 2.08