Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (32 species) not a true protein |
Species Thermoplasma acidophilum [TaxId:2303] [225555] (4 PDB entries) |
Domain d3k9ua_: 3k9u A: [212252] automated match to d1tiqa_ complexed with aco, br, cl, ni |
PDB Entry: 3k9u (more details), 2.3 Å
SCOPe Domain Sequences for d3k9ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k9ua_ d.108.1.0 (A:) automated matches {Thermoplasma acidophilum [TaxId: 2303]} msieirklsiedletlievareswkwtyagiyseeyieswirekyskekllneivrsqsn ldilflgafadstligfielkiiankaellrlylkpeythkkigktllleaekimkkkgi lecrlyvhrqnsvgfsfyykngfkvedtdgsdfimekky
Timeline for d3k9ua_: