Lineage for d1d6vh2 (1d6v H:114-214)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549023Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 549027Species Human (Homo sapiens) [TaxId:9606] [88575] (105 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 549064Domain d1d6vh2: 1d6v H:114-214 [21213]
    Other proteins in same PDB: d1d6vh1, d1d6vl1, d1d6vl2
    part of humanized oxy-cope catalytic Fab az-28

Details for d1d6vh2

PDB Entry: 1d6v (more details), 2 Å

PDB Description: conformation effects in biological catalysis introduced by oxy-cope antibody maturation

SCOP Domain Sequences for d1d6vh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6vh2 b.1.1.2 (H:114-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOP Domain Coordinates for d1d6vh2:

Click to download the PDB-style file with coordinates for d1d6vh2.
(The format of our PDB-style files is described here.)

Timeline for d1d6vh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d6vh1