Lineage for d1d6vh2 (1d6v H:114-214)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655115Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 655162Domain d1d6vh2: 1d6v H:114-214 [21213]
    Other proteins in same PDB: d1d6vh1, d1d6vl1, d1d6vl2
    part of humanized oxy-cope catalytic Fab az-28

Details for d1d6vh2

PDB Entry: 1d6v (more details), 2 Å

PDB Description: conformation effects in biological catalysis introduced by oxy-cope antibody maturation
PDB Compounds: (H:) chimeric germline precursor of oxy-cope catalytic antibody az-28 (heavy chain)

SCOP Domain Sequences for d1d6vh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6vh2 b.1.1.2 (H:114-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOP Domain Coordinates for d1d6vh2:

Click to download the PDB-style file with coordinates for d1d6vh2.
(The format of our PDB-style files is described here.)

Timeline for d1d6vh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d6vh1