Lineage for d3jvla1 (3jvl A:349-460)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993780Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1993781Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1993941Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1993942Protein automated matches [190615] (10 species)
    not a true protein
  7. 1994805Species Mouse (Mus musculus) [TaxId:10090] [196526] (5 PDB entries)
  8. 1994806Domain d3jvla1: 3jvl A:349-460 [212122]
    Other proteins in same PDB: d3jvla2
    automated match to d3jvma_
    complexed with bme, edo

Details for d3jvla1

PDB Entry: 3jvl (more details), 1.2 Å

PDB Description: Crystal structure of bromodomain 2 of mouse Brd4
PDB Compounds: (A:) Bromodomain-containing protein 4

SCOPe Domain Sequences for d3jvla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jvla1 a.29.2.0 (A:349-460) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
skiseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstikskl
esreyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmpd

SCOPe Domain Coordinates for d3jvla1:

Click to download the PDB-style file with coordinates for d3jvla1.
(The format of our PDB-style files is described here.)

Timeline for d3jvla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3jvla2