SCOP 1.55: Domain d1yedb2: 1yed B:116-217

Lineage for d1yedb2 (1yed B:116-217)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab D2.4 (mouse), kappa L chain [49046] (1 PDB entry)

8. Domain d1yedb2: 1yed B:116-217 [21181]
   Other proteins in same PDB: d1yeda1, d1yedb1, d1yedh1, d1yedl1

Details for d1yedb2

PDB Entry: 1yed, 3.1 Å

PDB Description: structure of a catalytic antibody igg2a fab fragment (d2.4)

SCOP Domain Sequences for d1yedb2:

Sequence; same for both SEQRES and ATOM records:

>d1yedb2 b.1.1.2 (B:116-217) Immunoglobulin (constant domains of L and H chains) {Fab D2.4 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

Timeline for d1yedb2:

• d1yedb2 appears in SCOP 1.57
  
• d1yedb2 appears in the current release, SCOPe 2.08