SCOP 1.55: Domain d1yedh1: 1yed H:1-113

Lineage for d1yedh1 (1yed H:1-113)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab D2.4 (mouse), kappa L chain [48830] (1 PDB entry)

8. Domain d1yedh1: 1yed H:1-113 [20149]
   Other proteins in same PDB: d1yeda2, d1yedb2, d1yedh2, d1yedl2

Details for d1yedh1

PDB Entry: 1yed, 3.1 Å

PDB Description: structure of a catalytic antibody igg2a fab fragment (d2.4)

SCOP Domain Sequences for d1yedh1:

Sequence; same for both SEQRES and ATOM records:

>d1yedh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab D2.4 (mouse), kappa L chain}
avklqqsgpelvrpgtsvklscktsgyiftsywihwlkqssgqglewiariypgtggtyy
nekfkgkatltadkssstaymqlsslksedsavyfctrwgfttvrenyyamdywgqgtlv
tvss

Timeline for d1yedh1:

• d1yedh1 appears in SCOP 1.57
  
• d1yedh1 appears in the current release, SCOPe 2.08