Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (94 species) not a true protein |
Species Herpetosiphon aurantiacus [TaxId:316274] [225737] (1 PDB entry) |
Domain d3ik4b1: 3ik4 B:2-126 [211747] Other proteins in same PDB: d3ik4a2, d3ik4a3, d3ik4a4, d3ik4b2, d3ik4b3, d3ik4b4, d3ik4c2, d3ik4c3, d3ik4c4, d3ik4d2, d3ik4d3, d3ik4d4 automated match to d1jpma2 complexed with gol, k |
PDB Entry: 3ik4 (more details), 2.1 Å
SCOPe Domain Sequences for d3ik4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ik4b1 d.54.1.0 (B:2-126) automated matches {Herpetosiphon aurantiacus [TaxId: 316274]} pttiqaisaeainlpltepfaiasgaqavaanvlvkvqladgtlglgeaapfpavsgetq tgtsaaierlqshllgadvrgwrklaamldhaeheaaaarcglemamldaltrhyhmplh vffgg
Timeline for d3ik4b1: