Lineage for d3ik4b1 (3ik4 B:2-126)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191540Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2191541Protein automated matches [226922] (88 species)
    not a true protein
  7. 2191894Species Herpetosiphon aurantiacus [TaxId:316274] [225737] (1 PDB entry)
  8. 2191896Domain d3ik4b1: 3ik4 B:2-126 [211747]
    Other proteins in same PDB: d3ik4a2, d3ik4a3, d3ik4a4, d3ik4b2, d3ik4b3, d3ik4b4, d3ik4c2, d3ik4c3, d3ik4c4, d3ik4d2, d3ik4d3, d3ik4d4
    automated match to d1jpma2
    complexed with gol, k

Details for d3ik4b1

PDB Entry: 3ik4 (more details), 2.1 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing protein from herpetosiphon aurantiacus
PDB Compounds: (B:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3ik4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ik4b1 d.54.1.0 (B:2-126) automated matches {Herpetosiphon aurantiacus [TaxId: 316274]}
pttiqaisaeainlpltepfaiasgaqavaanvlvkvqladgtlglgeaapfpavsgetq
tgtsaaierlqshllgadvrgwrklaamldhaeheaaaarcglemamldaltrhyhmplh
vffgg

SCOPe Domain Coordinates for d3ik4b1:

Click to download the PDB-style file with coordinates for d3ik4b1.
(The format of our PDB-style files is described here.)

Timeline for d3ik4b1: