SCOPe 2.05: Domain d3i5vd_: 3i5v D:

Lineage for d3i5vd_ (3i5v D:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (4 families)

5. Family d.151.1.0: automated matches [191468] (1 protein)
   not a true family

6. Protein automated matches [190734] (8 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:561307] [225915] (4 PDB entries)

8. Domain d3i5vd_: 3i5v D: [211499]
   automated match to d1zwxa1
   complexed with dga

Details for d3i5vd_

PDB Entry: 3i5v, 2.8 Å

PDB Description: Crystal structure of beta toxin 275-280 from Staphylococcus aureus

PDB Compounds: (D:) Beta-hemolysin

SCOPe Domain Sequences for d3i5vd_:

Sequence; same for both SEQRES and ATOM records:

>d3i5vd_ d.151.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 561307]}
dlklvshnvymlstvlypnwgqykradligqssyiknndvvifneafdngasdkllsnvk
keypyqtpvlgrsqsgwdktegsysstvaedggvaivskypikekiqhvfksgcgfdnds
nkgfvytkiekngknvhvigthtqsedsrcgaghdrkiraeqmkeisdfvkkknipkdet
vyiggdlnvnkgtpefkdmlknlnvndvlyaghnstwdpqsnsiakynypngkpehldyi
ftdkdhkqpkqlvnevvtekpkpwdvdgyvyndfsdhypikaysk

Timeline for d3i5vd_:

• d3i5vd_ first appeared in SCOPe 2.03
  
• d3i5vd_ appears in SCOPe 2.04
  
• d3i5vd_ appears in SCOPe 2.06
  
• d3i5vd_ appears in the current release, SCOPe 2.08