SCOPe 2.04: Domain d3i12a2: 3i12 A:140-363

Lineage for d3i12a2 (3i12 A:140-363)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (25 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [225724] (1 PDB entry)

8. Domain d3i12a2: 3i12 A:140-363 [211418]
   Other proteins in same PDB: d3i12a1, d3i12b1, d3i12c1, d3i12d1
   automated match to d1ehib2
   complexed with adp

Details for d3i12a2

PDB Entry: 3i12, 2.2 Å

PDB Description: The crystal structure of the D-alanyl-alanine synthetase A from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2

PDB Compounds: (A:) D-alanine-D-alanine ligase A

SCOPe Domain Sequences for d3i12a2:

Sequence, based on SEQRES records:

>d3i12a2 d.142.1.0 (A:140-363) automated matches {Salmonella typhimurium [TaxId: 90371]}
dkdvakrllrdaglniapfitltrtnrhafsfaevesrlglplfvkpanqgssvgvskva
neaqyqqavalafefdhkvvveqgikgreiecavlgndnpqastcgeivlnsefyaydtk
yiddngaqvvvpaqipsevndkiraiaiqayqtlgcagmarvdvfltadnevvineintl
pgftnismypklwqasglgytdlisrlielalerhtannalktt

Sequence, based on observed residues (ATOM records):

>d3i12a2 d.142.1.0 (A:140-363) automated matches {Salmonella typhimurium [TaxId: 90371]}
dkdvakrllrdaglniapfitltrtnrhafsfaevesrlglplfvkpanqgssvgvskva
neaqyqqavalafefdhkvvveqgikgreiecavlgndnpqastcgeivlnsefydtkyi
ddngaqvvvpaqipsevndkiraiaiqayqtlgcagmarvdvfltadnevvineintlpg
ftnismypklwqasglgytdlisrlielalerhtannalktt

Timeline for d3i12a2:

• d3i12a2 first appeared in SCOPe 2.03
  
• d3i12a2 appears in SCOPe 2.05
  
• d3i12a2 appears in the current release, SCOPe 2.08