Lineage for d3hsea_ (3hse A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1260111Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1260112Protein automated matches [190154] (41 species)
    not a true protein
  7. 1260299Species Staphylococcus aureus [TaxId:426430] [225722] (4 PDB entries)
  8. 1260308Domain d3hsea_: 3hse A: [211296]
    automated match to d2bv6a1

Details for d3hsea_

PDB Entry: 3hse (more details), 2.9 Å

PDB Description: crystal structure of staphylococcus aureus protein sarz in reduced form
PDB Compounds: (A:) HTH-type transcriptional regulator sarZ

SCOPe Domain Sequences for d3hsea_:

Sequence, based on SEQRES records: (download)

>d3hsea_ a.4.5.0 (A:) automated matches {Staphylococcus aureus [TaxId: 426430]}
gshmylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgerv
fldsgtltpllkklekkdyvvrtreekdernlqislteqgkaiksplaeisvkvfnefni
sereasdiinnlrnfvs

Sequence, based on observed residues (ATOM records): (download)

>d3hsea_ a.4.5.0 (A:) automated matches {Staphylococcus aureus [TaxId: 426430]}
gshmylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendenikklgervfl
dsgtltpllkklkdyteqgkaiksplaeisvkvfnefnisereasdiinnlrnfvs

SCOPe Domain Coordinates for d3hsea_:

Click to download the PDB-style file with coordinates for d3hsea_.
(The format of our PDB-style files is described here.)

Timeline for d3hsea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3hseb_