Lineage for d3hrxd_ (3hrx D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2854396Species Thermus thermophilus HB8 [TaxId:300852] [225694] (2 PDB entries)
  8. 2854406Domain d3hrxd_: 3hrx D: [211293]
    automated match to d4fzwc_

Details for d3hrxd_

PDB Entry: 3hrx (more details), 1.85 Å

PDB Description: crystal structure of phenylacetic acid degradation protein paag
PDB Compounds: (D:) Probable enoyl-CoA hydratase

SCOPe Domain Sequences for d3hrxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hrxd_ c.14.1.0 (D:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mvlkerqdgvlvltlnrpeklnaitgelldalyaalkegeedrevrallltgagrafsag
qdltefgdrkpdyeahlrrynrvvealsglekplvvavngvaagagmslalwgdlrlaav
gasfttafvriglvpdsglsfllprlvglakaqellllsprlsaeealalglvhrvvpae
klmeealslakelaqgptrayaltkkllletyrlsltealaleavlqgqagqtqdheegv
rafrekrpprfqgr

SCOPe Domain Coordinates for d3hrxd_:

Click to download the PDB-style file with coordinates for d3hrxd_.
(The format of our PDB-style files is described here.)

Timeline for d3hrxd_: