Lineage for d3hqpe1 (3hqp E:1-87,E:187-357)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2100061Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2100062Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 2100063Protein Pyruvate kinase, N-terminal domain [51623] (6 species)
    this domain is interrupted by an all-beta domain
    C-terminal domain is alpha/beta
  7. 2100163Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51626] (11 PDB entries)
  8. 2100174Domain d3hqpe1: 3hqp E:1-87,E:187-357 [211242]
    Other proteins in same PDB: d3hqpa2, d3hqpa3, d3hqpb2, d3hqpb3, d3hqpc2, d3hqpc3, d3hqpd2, d3hqpd3, d3hqpe2, d3hqpe3, d3hqpf2, d3hqpf3, d3hqpg2, d3hqpg3, d3hqph2, d3hqph3, d3hqpi2, d3hqpi3, d3hqpj2, d3hqpj3, d3hqpk2, d3hqpk3, d3hqpl2, d3hqpl3, d3hqpm2, d3hqpm3, d3hqpn2, d3hqpn3, d3hqpo2, d3hqpo3, d3hqpp2, d3hqpp3
    automated match to d1pkla2
    complexed with atp, fdp, gol, k, mg, oxl

Details for d3hqpe1

PDB Entry: 3hqp (more details), 2.3 Å

PDB Description: crystal structure of leishmania mexicana pyruvate kinase (lmpyk) in complex with atp, oxalate and fructose 2,6 bisphosphate
PDB Compounds: (E:) pyruvate kinase

SCOPe Domain Sequences for d3hqpe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hqpe1 c.1.12.1 (E:1-87,E:187-357) Pyruvate kinase, N-terminal domain {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
qttinnvrqaaaelgvniaialdtkgpXpavsakdrvdlqfgveqgvdmifasfirsaeq
vgdvrkalgpkgrdimiickienhqgvqnidsiieesdgimvargdlgveipaekvvvaq
kiliskcnvagkpvicatqmlesmtynprptraevsdvanavfngadcvmlsgetakgky
pnevvqymaricleaqsal

SCOPe Domain Coordinates for d3hqpe1:

Click to download the PDB-style file with coordinates for d3hqpe1.
(The format of our PDB-style files is described here.)

Timeline for d3hqpe1:

View in 3D
Domains from other chains:
(mouse over for more information)
d3hqpa1, d3hqpa2, d3hqpa3, d3hqpb1, d3hqpb2, d3hqpb3, d3hqpc1, d3hqpc2, d3hqpc3, d3hqpd1, d3hqpd2, d3hqpd3, d3hqpf1, d3hqpf2, d3hqpf3, d3hqpg1, d3hqpg2, d3hqpg3, d3hqph1, d3hqph2, d3hqph3, d3hqpi1, d3hqpi2, d3hqpi3, d3hqpj1, d3hqpj2, d3hqpj3, d3hqpk1, d3hqpk2, d3hqpk3, d3hqpl1, d3hqpl2, d3hqpl3, d3hqpm1, d3hqpm2, d3hqpm3, d3hqpn1, d3hqpn2, d3hqpn3, d3hqpo1, d3hqpo2, d3hqpo3, d3hqpp1, d3hqpp2, d3hqpp3