Lineage for d1nsnl2 (1nsn L:108-213)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1108335Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1108556Species Mouse (Mus musculus) [TaxId:10090] [88567] (317 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 1108856Domain d1nsnl2: 1nsn L:108-213 [21102]
    Other proteins in same PDB: d1nsnh1, d1nsnh2, d1nsnl1, d1nsns_
    part of Fab N10

Details for d1nsnl2

PDB Entry: 1nsn (more details), 2.8 Å

PDB Description: the crystal structure of antibody n10-staphylococcal nuclease complex at 2.9 angstroms resolution
PDB Compounds: (L:) igg fab (igg1, kappa)

SCOPe Domain Sequences for d1nsnl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nsnl2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d1nsnl2:

Click to download the PDB-style file with coordinates for d1nsnl2.
(The format of our PDB-style files is described here.)

Timeline for d1nsnl2: