Lineage for d3hfzb3 (3hfz B:191-399)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2089141Fold b.153: PheT/TilS domain [56036] (1 superfamily)
    core: 3 layers; contains beta-sandwich of unusual topology
  4. 2089142Superfamily b.153.1: PheT/TilS domain [56037] (2 families) (S)
    contains putative tRNA-binding structural motif
  5. 2089143Family b.153.1.1: B3/B4 domain of PheRS, PheT [56038] (1 protein)
    Pfam PF03483; decorated with additional structures
  6. 2089144Protein B3/B4 domain of PheRS, PheT [56039] (1 species)
  7. 2089145Species Thermus thermophilus [TaxId:274] [56040] (12 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 2089156Domain d3hfzb3: 3hfz B:191-399 [211012]
    Other proteins in same PDB: d3hfza_, d3hfzb1, d3hfzb2, d3hfzb4, d3hfzb5, d3hfzb6
    automated match to d1jjcb6
    complexed with mty

Details for d3hfzb3

PDB Entry: 3hfz (more details), 2.9 Å

PDB Description: crystal structure of thermus thermophilus phenylalanyl-trna synthetase complexed with m-tyrosine
PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d3hfzb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hfzb3 b.153.1.1 (B:191-399) B3/B4 domain of PheRS, PheT {Thermus thermophilus [TaxId: 274]}
lkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmrpinnvvdvtn
yvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlviagwrgeesfp
lglagvmggaesevredteaialevacfdpvsirktarrhglrteashrfergvdplgqv
paqrralsllqalagarvaealleagspk

SCOPe Domain Coordinates for d3hfzb3:

Click to download the PDB-style file with coordinates for d3hfzb3.
(The format of our PDB-style files is described here.)

Timeline for d3hfzb3: