SCOPe 2.05: Domain d3hb8c_: 3hb8 C:

Lineage for d3hb8c_ (3hb8 C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55840] (24 PDB entries)

8. Domain d3hb8c_: 3hb8 C: [210972]
   automated match to d2aaza_
   complexed with edo, po4, ump

Details for d3hb8c_

PDB Entry: 3hb8, 2.74 Å

PDB Description: structures of thymidylate synthase r163k with substrates and inhibitors show subunit asymmetry

PDB Compounds: (C:) Thymidylate synthase

SCOPe Domain Sequences for d3hb8c_:

Sequence; same for both SEQRES and ATOM records:

>d3hb8c_ d.117.1.1 (C:) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae
yrdmesdysgqgvdqlqkvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn
selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl
kiqlqreprpfpklrilrkvekiddfkaedfqiegynphpt

Timeline for d3hb8c_:

• d3hb8c_ first appeared in SCOPe 2.03
  
• d3hb8c_ appears in SCOPe 2.04
  
• d3hb8c_ appears in SCOPe 2.06
  
• d3hb8c_ appears in the current release, SCOPe 2.08