Lineage for d3h9kc_ (3h9k C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212073Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2212074Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2212075Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2212113Protein Thymidylate synthase [55833] (7 species)
  7. 2212254Species Human (Homo sapiens) [TaxId:9606] [55840] (26 PDB entries)
  8. 2212275Domain d3h9kc_: 3h9k C: [210914]
    automated match to d2aaza_
    complexed with edo, po4, ufp

Details for d3h9kc_

PDB Entry: 3h9k (more details), 2.65 Å

PDB Description: structures of thymidylate synthase r163k with substrates and inhibitors show subunit asymmetry
PDB Compounds: (C:) Thymidylate synthase

SCOPe Domain Sequences for d3h9kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h9kc_ d.117.1.1 (C:) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae
yrdmesdysgqgvdqlqkvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn
selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl
kiqlqreprpfpklrilrkvekiddfkaedfqiegynphpt

SCOPe Domain Coordinates for d3h9kc_:

Click to download the PDB-style file with coordinates for d3h9kc_.
(The format of our PDB-style files is described here.)

Timeline for d3h9kc_: