SCOPe 2.04: Domain d3h8mb_: 3h8m B:

Lineage for d3h8mb_ (3h8m B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188353] (18 PDB entries)

8. Domain d3h8mb_: 3h8m B: [210910]
   automated match to d1b4fb_

Details for d3h8mb_

PDB Entry: 3h8m, 2.1 Å

PDB Description: sam domain of human ephrin type-a receptor 7 (epha7)

PDB Compounds: (B:) Ephrin type-A receptor 7

SCOPe Domain Sequences for d3h8mb_:

Sequence; same for both SEQRES and ATOM records:

>d3h8mb_ a.60.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
enlyfqgtpdfttfcsvgewlqaikmerykdnftaagynslesvarmtiedvmslgitlv
ghqkkimssiqtmraqmlh

Timeline for d3h8mb_:

• d3h8mb_ first appeared in SCOPe 2.03
  
• d3h8mb_ appears in SCOPe 2.05
  
• d3h8mb_ appears in the current release, SCOPe 2.08, called d3h8mb1