Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
Protein automated matches [226882] (10 species) not a true protein |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225719] (6 PDB entries) |
Domain d3h3fb2: 3h3f B:160-331 [210817] Other proteins in same PDB: d3h3fa1, d3h3fb1, d3h3fc1, d3h3fd1, d3h3fe1, d3h3ff1, d3h3fg1, d3h3fh1 automated match to d9ldta2 complexed with act, nai, oxm |
PDB Entry: 3h3f (more details), 2.38 Å
SCOPe Domain Sequences for d3h3fb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h3fb2 d.162.1.1 (B:160-331) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} sgcnldsarfrylmgerlgvhalschgwilgehgdssvpvwsgmnvagvslktlhpelgt dadkeqwkqvhkqvvdsayeviklkgyttwaiglsvadlaesimknlrrvhpistmlkgl ygikedvflsvpcvlgqngisdvvkvtltseeeahlkksadtlwgiqkelqf
Timeline for d3h3fb2: