Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (25 species) not a true protein |
Species Francisella tularensis [TaxId:119856] [225666] (1 PDB entry) |
Domain d3h1sa2: 3h1s A:84-191 [210781] Other proteins in same PDB: d3h1sa1, d3h1sb1 automated match to d1jr9a2 complexed with fe, gol |
PDB Entry: 3h1s (more details), 1.9 Å
SCOPe Domain Sequences for d3h1sa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h1sa2 d.44.1.0 (A:84-191) automated matches {Francisella tularensis [TaxId: 119856]} nkteassqlkaalietfgsvenfkeqfskaaiatfgsgwawlvkntegkleivttsnagc pltenkkplltfdvwehayyidyrnarpkyvealwdivnwqfvseqfa
Timeline for d3h1sa2: