Lineage for d3gncb1 (3gnc B:4-242)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246106Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2246107Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2246252Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 2246253Protein automated matches [226934] (25 species)
    not a true protein
  7. 2246298Species Burkholderia pseudomallei [TaxId:320372] [225462] (6 PDB entries)
  8. 2246308Domain d3gncb1: 3gnc B:4-242 [210611]
    Other proteins in same PDB: d3gnca2, d3gncb2, d3gncc2, d3gncd2
    automated match to d1siqa2
    complexed with epe, qqq, so4

Details for d3gncb1

PDB Entry: 3gnc (more details), 2.15 Å

PDB Description: Crystal structure of Glutaryl-COA dehydrogenase from Burkholderia Pseudomallei with fragment 6421
PDB Compounds: (B:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3gncb1:

Sequence, based on SEQRES records: (download)

>d3gncb1 e.6.1.0 (B:4-242) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
lpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvfvvwa
kldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkg

Sequence, based on observed residues (ATOM records): (download)

>d3gncb1 e.6.1.0 (B:4-242) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
lpklatgewigcfgltepmvtrarkvpggyslsgskmwitnspiadvfvvwakldedeir
gfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkg

SCOPe Domain Coordinates for d3gncb1:

Click to download the PDB-style file with coordinates for d3gncb1.
(The format of our PDB-style files is described here.)

Timeline for d3gncb1: