Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) duplication: consists of two similar domain swapped with C-terminal strands |
Family d.21.1.0: automated matches [191386] (1 protein) not a true family |
Protein automated matches [190491] (18 species) not a true protein |
Species Eubacterium barkeri [TaxId:1528] [225714] (1 PDB entry) |
Domain d3g7ka1: 3g7k A:2-170 [210431] Other proteins in same PDB: d3g7kb3 automated match to d2h9fa1 |
PDB Entry: 3g7k (more details), 2.7 Å
SCOPe Domain Sequences for d3g7ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g7ka1 d.21.1.0 (A:2-170) automated matches {Eubacterium barkeri [TaxId: 1528]} sdqmripcvimragtskgiflkgndlpadqelrdkvilrifgspdvrqidglagadplts klaiigpsthpdadvdytfaqvsitdavvdyngncgnisagvgpfaidesfvkavepmtr vcihntntgkllyaevevedgkakvsgdckidgvpgtnapelmdfsdta
Timeline for d3g7ka1: