Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (94 species) not a true protein |
Species Salmonella typhimurium [TaxId:99287] [225609] (1 PDB entry) |
Domain d3g0sa1: 3g0s A:1-292 [210298] Other proteins in same PDB: d3g0sa2, d3g0sb2 automated match to d3l21a_ complexed with cl, gol, mg |
PDB Entry: 3g0s (more details), 1.85 Å
SCOPe Domain Sequences for d3g0sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g0sa1 c.1.10.0 (A:1-292) automated matches {Salmonella typhimurium [TaxId: 99287]} mftgsivalvtpmdekgnvsrsclkklidyhvangtsaivsvgttgesatlshdehgdvv mmtleladgripviagtganataeaisltqrfndsgivgcltvtpyynrptqeglfqhfk aiaehtdlpqilynvpsrtgcdmlpetvgrlaeikniiaikeatgnltrvhqikelvsdd fillsgddasaldfmqlgghgvisvtanvaaremadmcklaaegqfaearainqrlmplh nklfvepnpipvkwackalglvatdtlrlpmtpitdhgrdivkaalqhagll
Timeline for d3g0sa1: