SCOPe 2.03: Domain d3fsjx2: 3fsj X:182-341

Lineage for d3fsjx2 (3fsj X:182-341)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
   N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold

6. Protein Benzoylformate decarboxylase [52482] (1 species)

7. Species Pseudomonas putida [TaxId:303] [52483] (10 PDB entries)
   Uniprot P20906

8. Domain d3fsjx2: 3fsj X:182-341 [210085]
   Other proteins in same PDB: d3fsjx1, d3fsjx3
   automated match to d1mcza1
   complexed with ca, d7k

Details for d3fsjx2

PDB Entry: 3fsj, 1.37 Å

PDB Description: Crystal structure of benzoylformate decarboxylase in complex with the inhibitor MBP

PDB Compounds: (X:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d3fsjx2:

Sequence; same for both SEQRES and ATOM records:

>d3fsjx2 c.31.1.3 (X:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
pleaarapmgdaivadigamasalanlveessrqlptaap

Timeline for d3fsjx2:

• d3fsjx2 is new in SCOPe 2.03-stable
  
• d3fsjx2 appears in SCOPe 2.04
  
• d3fsjx2 appears in the current release, SCOPe 2.08