Lineage for d3fr8b2 (3fr8 B:308-593)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721358Family a.100.1.2: Acetohydroxy acid isomeroreductase (ketol-acid reductoisomerase, KARI) [48184] (3 proteins)
  6. 2721375Protein automated matches [227000] (2 species)
    not a true protein
  7. 2721381Species Oryza sativa [TaxId:39947] [225644] (2 PDB entries)
  8. 2721385Domain d3fr8b2: 3fr8 B:308-593 [210073]
    Other proteins in same PDB: d3fr8a1, d3fr8b1
    automated match to d1qmga1
    complexed with mg, ndp, pe4, peg, so4

Details for d3fr8b2

PDB Entry: 3fr8 (more details), 2.8 Å

PDB Description: rice Ketolacid reductoisomerase in complex with Mg2+-NADPH
PDB Compounds: (B:) Putative ketol-acid reductoisomerase (Os05g0573700 protein)

SCOPe Domain Sequences for d3fr8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fr8b2 a.100.1.2 (B:308-593) automated matches {Oryza sativa [TaxId: 39947]}
leqeyksdifgergillgavhgivealfrryteqgmdeemaykntvegitgiisktiskk
gmlevynslteegkkefnkaysasfypcmdilyecyedvasgseirsvvlagrrfyekeg
lpafpmgnidqtrmwkvgekvrstrpendlgplhpftagvyvalmmaqievlrkkghsys
eiinesviesvdslnpfmhargvafmvdncsttarlgsrkwaprfdyiltqqafvtvdkd
apinqdlisnfmsdpvhgaievcaelrptvdisvpanadfvrpelr

SCOPe Domain Coordinates for d3fr8b2:

Click to download the PDB-style file with coordinates for d3fr8b2.
(The format of our PDB-style files is described here.)

Timeline for d3fr8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fr8b1