Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species) |
Species Fab HC19 (mouse), lambda L chain [49001] (4 PDB entries) |
Domain d1gigl2: 1gig L:111-210 [21004] Other proteins in same PDB: d1gigh1, d1gigl1 |
PDB Entry: 1gig (more details), 2.3 Å
SCOP Domain Sequences for d1gigl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gigl2 b.1.1.2 (L:111-210) Immunoglobulin (constant domains of L and H chains) {Fab HC19 (mouse), lambda L chain} qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq snnkymassyltltarawerhssyscqvtheghtveksls
Timeline for d1gigl2: