Lineage for d1gigl2 (1gig L:111-210)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159858Species Fab HC19 (mouse), lambda L chain [49001] (4 PDB entries)
  8. 159860Domain d1gigl2: 1gig L:111-210 [21004]
    Other proteins in same PDB: d1gigh1, d1gigl1

Details for d1gigl2

PDB Entry: 1gig (more details), 2.3 Å

PDB Description: refined three-dimensional structure of the fab fragment of a murine igg1, lambda antibody

SCOP Domain Sequences for d1gigl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gigl2 b.1.1.2 (L:111-210) Immunoglobulin (constant domains of L and H chains) {Fab HC19 (mouse), lambda L chain}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtveksls

SCOP Domain Coordinates for d1gigl2:

Click to download the PDB-style file with coordinates for d1gigl2.
(The format of our PDB-style files is described here.)

Timeline for d1gigl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gigl1