Lineage for d3fj5b_ (3fj5 B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1536113Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1536554Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 1536555Protein automated matches [190457] (8 species)
    not a true protein
  7. 1536585Species Chicken (Gallus gallus) [TaxId:9031] [225620] (7 PDB entries)
  8. 1536593Domain d3fj5b_: 3fj5 B: [209952]
    automated match to d1ynza_
    complexed with act, gol, pg4, pge, so4

Details for d3fj5b_

PDB Entry: 3fj5 (more details), 1.65 Å

PDB Description: crystal structure of the c-src-sh3 domain
PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d3fj5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fj5b_ b.34.2.0 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mtfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvaps

SCOPe Domain Coordinates for d3fj5b_:

Click to download the PDB-style file with coordinates for d3fj5b_.
(The format of our PDB-style files is described here.)

Timeline for d3fj5b_: