SCOPe 2.05: Domain d3fj5b_: 3fj5 B:

Lineage for d3fj5b_ (3fj5 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (8 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [225620] (11 PDB entries)

8. Domain d3fj5b_: 3fj5 B: [209952]
   automated match to d1ynza_
   complexed with act, gol, pg4, pge, so4

Details for d3fj5b_

PDB Entry: 3fj5, 1.65 Å

PDB Description: crystal structure of the c-src-sh3 domain

PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d3fj5b_:

Sequence; same for both SEQRES and ATOM records:

>d3fj5b_ b.34.2.0 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mtfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvaps

Timeline for d3fj5b_:

• d3fj5b_ first appeared in SCOPe 2.03
  
• d3fj5b_ appears in SCOPe 2.04
  
• d3fj5b_ is called d3fj5b1 in SCOPe 2.06
  
• d3fj5b_ appears in the current release, SCOPe 2.08, called d3fj5b1