Lineage for d3fhta2 (3fht A:300-466)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872051Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)
  8. 2872123Domain d3fhta2: 3fht A:300-466 [209933]
    automated match to d1xtia2
    protein/RNA complex; complexed with anp, gol, mg

Details for d3fhta2

PDB Entry: 3fht (more details), 2.2 Å

PDB Description: Crystal structure of human Dbp5 in complex with AMPPNP and RNA
PDB Compounds: (A:) ATP-dependent RNA helicase DDX19B

SCOPe Domain Sequences for d3fhta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fhta2 c.37.1.0 (A:300-466) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eeetldtikqyyvlcssrdekfqalcnlygaitiaqamifchtrktaswlaaelskeghq
vallsgemmveqraavierfregkekvlvttnvcargidveqvsvvinfdlpvdkdgnpd
netylhrigrtgrfgkrglavnmvdskhsmnilnriqehfnkkierl

SCOPe Domain Coordinates for d3fhta2:

Click to download the PDB-style file with coordinates for d3fhta2.
(The format of our PDB-style files is described here.)

Timeline for d3fhta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fhta1