SCOPe 2.05: Domain d3fhcb_: 3fhc B:

Lineage for d3fhcb_ (3fhc B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (102 PDB entries)

8. Domain d3fhcb_: 3fhc B: [209923]
   automated match to d2g9nb_
   protein/RNA complex

Details for d3fhcb_

PDB Entry: 3fhc, 2.8 Å

PDB Description: crystal structure of human dbp5 in complex with nup214

PDB Compounds: (B:) ATP-dependent RNA helicase DDX19B

SCOPe Domain Sequences for d3fhcb_:

Sequence; same for both SEQRES and ATOM records:

>d3fhcb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nqvevlqrdpnsplysvksfeelrlkpqllqgvyamgfnrpskiqenalplmlaeppqnl
iaqsqsgtgktaafvlamlsqvepankypqclclsptyelalqtgkvieqmgkfypelkl
ayavrgnklergqkiseqivigtpgtvldwcsklkfidpkkikvfvldeadvmiatqghq
dqsiriqrmlprncqmllfsatfedsvwkfaqkvvpdpnviklk

Timeline for d3fhcb_:

• d3fhcb_ first appeared in SCOPe 2.03
  
• d3fhcb_ appears in SCOPe 2.04
  
• d3fhcb_ appears in SCOPe 2.06
  
• d3fhcb_ appears in the current release, SCOPe 2.08