![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
![]() | Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) ![]() |
![]() | Family a.40.1.0: automated matches [227151] (1 protein) not a true family |
![]() | Protein automated matches [226856] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries) |
![]() | Domain d3ferd1: 3fer D:23-134 [209886] automated match to d1sh5a1 complexed with acy |
PDB Entry: 3fer (more details), 2.4 Å
SCOPe Domain Sequences for d3ferd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ferd1 a.40.1.0 (D:23-134) automated matches {Human (Homo sapiens) [TaxId: 9606]} pwkkiqqntftrwcnehlkcvnkrignlqtdlsdglrliallevlsqkrmyrkyhqrptf rqmqlenvsvalefldresiklvsidskaivdgnlklilglvwtlilhysis
Timeline for d3ferd1: