SCOPe 2.07: Domain d3ferc2: 3fer C:148-261

Lineage for d3ferc2 (3fer C:148-261)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.0: automated matches [227151] (1 protein)
   not a true family

6. Protein automated matches [226856] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries)

8. Domain d3ferc2: 3fer C:148-261 [209885]
   automated match to d1sh5a2
   complexed with acy

Details for d3ferc2

PDB Entry: 3fer, 2.4 Å

PDB Description: Crystal structure of n-terminal actin-binding domain from human filamin b (tandem ch-domains). northeast structural genomics consortium target hr5571a.

PDB Compounds: (C:) Filamin-B

SCOPe Domain Sequences for d3ferc2:

Sequence; same for both SEQRES and ATOM records:

>d3ferc2 a.40.1.0 (C:148-261) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kqtpkqrllgwiqnkipylpitnfnqnwqdgkalgalvdscapglcpdweswdpqkpvdn
areamqqaddwlgvpqvitpeeiihpdvdehsvmtylsqfpkaklkpgaplkpk

Timeline for d3ferc2:

• d3ferc2 first appeared in SCOPe 2.03
  
• d3ferc2 appears in SCOPe 2.06
  
• d3ferc2 appears in the current release, SCOPe 2.08