Lineage for d3etdd1 (3etd D:1-208)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2498096Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2498097Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2498098Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 2498236Protein automated matches [227004] (3 species)
    not a true protein
  7. 2498244Species Cow (Bos taurus) [TaxId:9913] [225673] (5 PDB entries)
  8. 2498254Domain d3etdd1: 3etd D:1-208 [209645]
    Other proteins in same PDB: d3etda2, d3etdb2, d3etdc2, d3etdd2, d3etde2, d3etdf2
    automated match to d1l1fa2
    complexed with b1t, glu, gtp, ndp

Details for d3etdd1

PDB Entry: 3etd (more details), 2.5 Å

PDB Description: structure of glutamate dehydrogenase complexed with bithionol
PDB Compounds: (D:) GLUD1 protein

SCOPe Domain Sequences for d3etdd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3etdd1 c.58.1.1 (D:1-208) automated matches {Cow (Bos taurus) [TaxId: 9913]}
adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrgilriikpcnhvls
lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
dtyastighydinahacvtgkpisqggi

SCOPe Domain Coordinates for d3etdd1:

Click to download the PDB-style file with coordinates for d3etdd1.
(The format of our PDB-style files is described here.)

Timeline for d3etdd1: