SCOPe 2.05: Domain d3ekua1: 3eku A:4-146

Lineage for d3ekua1 (3eku A:4-146)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (12 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225128] (12 PDB entries)

8. Domain d3ekua1: 3eku A:4-146 [209546]
   automated match to d1d4xa1
   complexed with atp, ca, cy9

Details for d3ekua1

PDB Entry: 3eku, 2.5 Å

PDB Description: crystal structure of monomeric actin bound to cytochalasin d

PDB Compounds: (A:) Actin-5C

SCOPe Domain Sequences for d3ekua1:

Sequence, based on SEQRES records:

>d3ekua1 c.55.1.1 (A:4-146) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
evaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqim
fetfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d3ekua1 c.55.1.1 (A:4-146) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
evaalvvdngsgmckagfagddapravfpsivgrprkdsyvgdeaqskrgiltlkypieh
givtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntpamy
vaiqavlslyasg

Timeline for d3ekua1:

• d3ekua1 first appeared in SCOPe 2.03
  
• d3ekua1 appears in SCOPe 2.04
  
• d3ekua1 appears in SCOPe 2.06
  
• d3ekua1 appears in the current release, SCOPe 2.08